RhoA Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: RhoA Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0272
• Hersteller Artikelnummer: A0272
• Alternativnummer: ABB-A0272-20UL,ABB-A0272-100UL,ABB-A0272-1000UL,ABB-A0272-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ARHA, ARH12, RHO12, EDFAOB, RHOH12, RhoA

Produktbeschreibung

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 22 kDa
• NCBI: 387
• UniProt: P61586
• Reinheit: Affinity purification
• Sequenz: NIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
• Target-Kategorie: RHOA
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:3000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,G protein signaling,Small G proteins,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Microfilaments,Microtubules,Actins,TGF-b-Smad Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway.

Bilder

Western blot analysis of lysates from HUVEC cells using RhoA Rabbit pAb (A0272) at 1:2000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60 s.

Immunohistochemistry analysis of paraffin-embedded Human placenta using RhoA Rabbit pAb (A0272) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Western blot analysis of various lysates using RhoA Rabbit pAb (A0272) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Immunohistochemistry analysis of paraffin-embedded Human placenta using RhoA Rabbit pAb (A0272) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunofluorescence analysis of NIH-3T3 cells using RhoA Rabbit pAb (A0272) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.