RhoA Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: RhoA Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0272
• Hersteller Artikelnummer: A0272
• Alternativnummer: ABB-A0272-20UL,ABB-A0272-100UL,ABB-A0272-1000UL,ABB-A0272-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ARHA, ARH12, RHO12, EDFAOB, RHOH12, RhoA

Produktbeschreibung

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 22kDa
• NCBI: 387
• UniProt: P61586
• Reinheit: Affinity purification
• Sequenz: NIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
• Target-Kategorie: RHOA
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,G protein signaling,Small G proteins,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Microfilaments,Microtubules,Actins,TGF-b-Smad Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway

Bilder