RhoA Rabbit pAb, Unconjugated

Catalog Number: ABB-A0272
Article Name: RhoA Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0272
Supplier Catalog Number: A0272
Alternative Catalog Number: ABB-A0272-20UL,ABB-A0272-100UL,ABB-A0272-1000UL,ABB-A0272-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ARHA, ARH12, RHO12, EDFAOB, RHOH12, RhoA
This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified.
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 387
UniProt: P61586
Purity: Affinity purification
Sequence: NIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Target: RHOA
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,G protein signaling,Small G proteins,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Microfilaments,Microtubules,Actins,TGF-b-Smad Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway