RYR2 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: RYR2 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0298
• Hersteller Artikelnummer: A0298
• Alternativnummer: ABB-A0298-20UL,ABB-A0298-100UL,ABB-A0298-500UL,ABB-A0298-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: RyR, ARVC2, ARVD2, RYR-2, VTSIP, VACRDS, RYR2

Produktbeschreibung

This gene encodes a ryanodine receptor found in cardiac muscle sarcoplasmic reticulum. The encoded protein is one of the components of a calcium channel, composed of a tetramer of the ryanodine receptor proteins and a tetramer of FK506 binding protein 1B proteins, that supplies calcium to cardiac muscle. Mutations in this gene are associated with stress-induced polymorphic ventricular tachycardia and arrhythmogenic right ventricular dysplasia.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 565kDa
• NCBI: 6262
• UniProt: Q92736
• Reinheit: Affinity purification
• Sequenz: DAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
• Target-Kategorie: RYR2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|IHC-P,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Neuroscience,Calcium Signaling,Cardiovascular,Hypoxia,Heart,Contractility,Cardiac arrhythmias

Bilder