RYR2 Rabbit pAb, Unconjugated

Product Overview

• Article Name: RYR2 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A0298
• Supplier Catalog Number: A0298
• Alternative Catalog Number: ABB-A0298-20UL,ABB-A0298-100UL,ABB-A0298-500UL,ABB-A0298-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: RyR, ARVC2, ARVD2, RYR-2, VTSIP, VACRDS, RYR2

Product Description

This gene encodes a ryanodine receptor found in cardiac muscle sarcoplasmic reticulum. The encoded protein is one of the components of a calcium channel, composed of a tetramer of the ryanodine receptor proteins and a tetramer of FK506 binding protein 1B proteins, that supplies calcium to cardiac muscle. Mutations in this gene are associated with stress-induced polymorphic ventricular tachycardia and arrhythmogenic right ventricular dysplasia.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 565 kDa
• NCBI: 6262
• UniProt: Q92736
• Purity: Affinity purification
• Sequence: DAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
• Target: RYR2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:2000|IF-P,1:50 - 1:200|IHC-P,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Neuroscience,Calcium Signaling,Cardiovascular,Hypoxia,Heart,Contractility,Cardiac arrhythmias.

Images

Immunohistochemistry analysis of paraffin-embedded Rat heart tissue using RYR2 Rabbit pAb (A0298) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human heart tissue using RYR2 Rabbit pAb (A0298) at a dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Western blot analysis of lysates from Mouse heart using RYR2 Rabbit pAb (A0298) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90 s.

Immunofluorescence analysis of paraffin-embedded mouse heart using RYR2 Rabbit pAb (A0298) at dilution of 1:200 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.