CD79a Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: CD79a Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0331
• Hersteller Artikelnummer: A0331
• Alternativnummer: ABB-A0331-100UL,ABB-A0331-20UL,ABB-A0331-500UL,ABB-A0331-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: IGA, MB1, MB-1, IGAlpha, CD79a

Produktbeschreibung

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 25kDa
• NCBI: 973
• UniProt: P11912
• Reinheit: Affinity purification
• Sequenz: FRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEK
• Target-Kategorie: CD79A
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor immunology,Immunology Inflammation,CDs,B Cell Receptor Signaling Pathway,Stem Cells,Hematopoietic Progenitors

Bilder