CD79a Rabbit pAb, Unconjugated

Product Overview

• Article Name: CD79a Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A0331
• Supplier Catalog Number: A0331
• Alternative Catalog Number: ABB-A0331-100UL,ABB-A0331-20UL,ABB-A0331-500UL,ABB-A0331-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: IGA, MB1, MB-1, IGAlpha, CD79a

Product Description

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-alpha protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 25kDa
• NCBI: 973
• UniProt: P11912
• Purity: Affinity purification
• Sequence: FRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEK
• Target: CD79A
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor immunology,Immunology Inflammation,CDs,B Cell Receptor Signaling Pathway,Stem Cells,Hematopoietic Progenitors

Images