PBRM1 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: PBRM1 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0334
• Hersteller Artikelnummer: A0334
• Alternativnummer: ABB-A0334-100UL,ABB-A0334-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PB1, RCC, BAF180, SMARCH1, PBRM1

Produktbeschreibung

This locus encodes a subunit of ATP-dependent chromatin-remodeling complexes. The encoded protein has been identified as in integral component of complexes necessary for ligand-dependent transcriptional activation by nuclear hormone receptors. Mutations at this locus have been associated with primary clear cell renal cell carcinoma.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC1820]
• Molekulargewicht: 193 kDa
• NCBI: 55193
• UniProt: Q86U86
• Reinheit: Affinity purification
• Sequenz: VLEAREPGSGRRLCDLFMVKPSKKDYPDYYKIILEPMDLKIIEHNIRNDKYAGEEGMIEDMKLMFRNARHYNEEGSQVYNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGISPKKSKYMTPMQQKLNEVYEAVKNYTDKRGRRL
• Target-Kategorie: PBRM1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:2000|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Chromatin Remodeling

Bilder