PBRM1 Rabbit mAb, Unconjugated

Product Overview

• Article Name: PBRM1 Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A0334
• Supplier Catalog Number: A0334
• Alternative Catalog Number: ABB-A0334-100UL,ABB-A0334-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PB1, RCC, BAF180, SMARCH1, PBRM1

Product Description

This locus encodes a subunit of ATP-dependent chromatin-remodeling complexes. The encoded protein has been identified as in integral component of complexes necessary for ligand-dependent transcriptional activation by nuclear hormone receptors. Mutations at this locus have been associated with primary clear cell renal cell carcinoma.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC1820]
• Molecular Weight: 193 kDa
• NCBI: 55193
• UniProt: Q86U86
• Purity: Affinity purification
• Sequence: VLEAREPGSGRRLCDLFMVKPSKKDYPDYYKIILEPMDLKIIEHNIRNDKYAGEEGMIEDMKLMFRNARHYNEEGSQVYNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGISPKKSKYMTPMQQKLNEVYEAVKNYTDKRGRRL
• Target: PBRM1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:2000|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Chromatin Remodeling

Images