CD31/PECAM1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: CD31/PECAM1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0378
• Hersteller Artikelnummer: A0378
• Alternativnummer: ABB-A0378-20UL,ABB-A0378-100UL,ABB-A0378-500UL,ABB-A0378-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CD31, PECA1, GPIIA, PECAM-1, endoCAM, CD31/EndoCAM

Produktbeschreibung

The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 83kDa
• NCBI: 5175
• UniProt: P16284
• Reinheit: Affinity purification
• Sequenz: AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
• Target-Kategorie: PECAM1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor immunology,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors,Mesenchymal Stem Cells,Cardiovascular,Angiogenesis,Blood

Bilder