CD31/PECAM1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: CD31/PECAM1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A0378
• Supplier Catalog Number: A0378
• Alternative Catalog Number: ABB-A0378-20UL,ABB-A0378-100UL,ABB-A0378-500UL,ABB-A0378-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CD31, PECA1, GPIIA, PECAM-1, endoCAM, CD31/EndoCAM

Product Description

The protein encoded by this gene is found on the surface of platelets, monocytes, neutrophils, and some types of T-cells, and makes up a large portion of endothelial cell intercellular junctions. The encoded protein is a member of the immunoglobulin superfamily and is likely involved in leukocyte migration, angiogenesis, and integrin activation.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 83kDa
• NCBI: 5175
• UniProt: P16284
• Purity: Affinity purification
• Sequence: AKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVRNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT
• Target: PECAM1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|IHC-P,1:50 - 1:200
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor immunology,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors,Mesenchymal Stem Cells,Cardiovascular,Angiogenesis,Blood

Images