Cytokeratin 13 (KRT13) Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: Cytokeratin 13 (KRT13) Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0411
• Hersteller Artikelnummer: A0411
• Alternativnummer: ABB-A0411-100UL,ABB-A0411-20UL,ABB-A0411-500UL,ABB-A0411-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: K13, CK13, WSN2, Cytokeratin 13 (KRT13)

Produktbeschreibung

The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. Mutations in this gene and keratin 4 have been associated with the autosomal dominant disorder White Sponge Nevus. The type I cytokeratins are clustered in a region of chromosome 17q21.2. Alternative splicing of this gene results in multiple transcript variants, however, not all variants have been described.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC1824]
• Molekulargewicht: 50 kDa
• NCBI: 3860
• UniProt: P13646
• Reinheit: Affinity purification
• Sequenz: LTGNEKITMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYYKTIEELRDKILTATIENNRVILEIDNARLAADDFRLKYENELAL
• Target-Kategorie: KRT13
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:5000 - 1:20000|IF-P,1:100 - 1:1000|IHC-P,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Extracellular Matrix,Keratin

Bilder