Cytokeratin 13 (KRT13) Rabbit mAb, Unconjugated

Catalog Number: ABB-A0411
Article Name: Cytokeratin 13 (KRT13) Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A0411
Supplier Catalog Number: A0411
Alternative Catalog Number: ABB-A0411-100UL,ABB-A0411-20UL,ABB-A0411-500UL,ABB-A0411-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: K13, CK13, WSN2, Cytokeratin 13 (KRT13)
The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. Mutations in this gene and keratin 4 have been associated with the autosomal dominant disorder White Sponge Nevus. The type I cytokeratins are clustered in a region of chromosome 17q21.2. Alternative splicing of this gene results in multiple transcript variants, however, not all variants have been described.
Clonality: Monoclonal
Clone Designation: [ARC1824]
Molecular Weight: 50 kDa
NCBI: 3860
UniProt: P13646
Purity: Affinity purification
Sequence: LTGNEKITMQNLNDRLASYLEKVRALEEANADLEVKIRDWHLKQSPASPERDYSPYYKTIEELRDKILTATIENNRVILEIDNARLAADDFRLKYENELAL
Target: KRT13
Antibody Type: Primary Antibody
Application Dilute: WB,1:5000 - 1:20000|IF-P,1:100 - 1:1000|IHC-P,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Extracellular Matrix,Keratin