Smad2 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Smad2 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0440
• Hersteller Artikelnummer: A0440
• Alternativnummer: ABB-A0440-20UL,ABB-A0440-100UL,ABB-A0440-500UL,ABB-A0440-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: JV18, LDS6, CHTD8, MADH2, MADR2, JV18-1, hMAD-2, hSMAD2, Smad2

Produktbeschreibung

The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene mothers against decapentaplegic (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signal of the transforming growth factor (TGF)-beta, and thus regulates multiple cellular processes, such as cell proliferation, apoptosis, and differentiation. This protein is recruited to the TGF-beta receptors through its interaction with the SMAD anchor for receptor activation (SARA) protein. In response to TGF-beta signal, this protein is phosphorylated by the TGF-beta receptors. The phosphorylation induces the dissociation of this protein with SARA and the association with the family member SMAD4. The association with SMAD4 is important for the translocation of this protein into the nucleus, where it binds to target promoters and forms a transcription repressor complex with other cofactors. This protein can also be phosphorylated by activin type 1 receptor kinase, and mediates the signal from the activin. Alternatively spliced transcript variants have been observed for this gene.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 52kDa
• NCBI: 4087
• UniProt: Q15796
• Reinheit: Affinity purification
• Sequenz: LPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSE
• Target-Kategorie: SMAD2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,TGF-b-Smad Signaling Pathway,ESC Pluripotency and Differentiation,Stem Cells,Cardiovascular,Angiogenesis

Bilder