Smad2 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0440
Article Name: Smad2 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0440
Supplier Catalog Number: A0440
Alternative Catalog Number: ABB-A0440-20UL,ABB-A0440-100UL,ABB-A0440-500UL,ABB-A0440-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: JV18, LDS6, CHTD8, MADH2, MADR2, JV18-1, hMAD-2, hSMAD2, Smad2
The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene mothers against decapentaplegic (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signal of the transforming growth factor (TGF)-beta, and thus regulates multiple cellular processes, such as cell proliferation, apoptosis, and differentiation. This protein is recruited to the TGF-beta receptors through its interaction with the SMAD anchor for receptor activation (SARA) protein. In response to TGF-beta signal, this protein is phosphorylated by the TGF-beta receptors. The phosphorylation induces the dissociation of this protein with SARA and the association with the family member SMAD4. The association with SMAD4 is important for the translocation of this protein into the nucleus, where it binds to target promoters and forms a transcription repressor complex with other cofactors. This protein can also be phosphorylated by activin type 1 receptor kinase, and mediates the signal from the activin. Alternatively spliced transcript variants have been observed for this gene.
Clonality: Polyclonal
Molecular Weight: 52kDa
NCBI: 4087
UniProt: Q15796
Purity: Affinity purification
Sequence: LPPVLVPRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELSPTTLSPVNHSLDLQPVTYSE
Target: SMAD2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors,TGF-b-Smad Signaling Pathway,ESC Pluripotency and Differentiation,Stem Cells,Cardiovascular,Angiogenesis