CTBP2 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A0463
Artikelname: CTBP2 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A0463
Hersteller Artikelnummer: A0463
Alternativnummer: ABB-A0463-20UL,ABB-A0463-100UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CTBP2, C-terminal-binding protein 2
This gene produces alternative transcripts encoding two distinct proteins. One protein is a transcriptional repressor, while the other isoform is a major component of specialized synapses known as synaptic ribbons. Both proteins contain a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. A portion of the 3 untranslated region was used to map this gene to chromosome 21q21.3, however, it was noted that similar loci elsewhere in the genome are likely. Blast analysis shows that this gene is present on chromosome 10. Several transcript variants encoding two different isoforms have been found for this gene.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2509]
Molekulargewicht: 49kDa
NCBI: 1488
UniProt: P56545
Reinheit: Affinity purification
Sequenz: TGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNEQ
Target-Kategorie: CTBP2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Neuroscience, Cell Type Marker,Neuron marker,Synapse marker