CTBP2 Rabbit mAb, Unconjugated

Catalog Number: ABB-A0463
Article Name: CTBP2 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A0463
Supplier Catalog Number: A0463
Alternative Catalog Number: ABB-A0463-20UL,ABB-A0463-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CTBP2, C-terminal-binding protein 2
This gene produces alternative transcripts encoding two distinct proteins. One protein is a transcriptional repressor, while the other isoform is a major component of specialized synapses known as synaptic ribbons. Both proteins contain a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. A portion of the 3 untranslated region was used to map this gene to chromosome 21q21.3, however, it was noted that similar loci elsewhere in the genome are likely. Blast analysis shows that this gene is present on chromosome 10. Several transcript variants encoding two different isoforms have been found for this gene.
Clonality: Monoclonal
Clone Designation: [ARC2509]
Molecular Weight: 49kDa
NCBI: 1488
UniProt: P56545
Purity: Affinity purification
Sequence: TGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNEQ
Target: CTBP2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Neuroscience, Cell Type Marker,Neuron marker,Synapse marker