TSC2 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A0492
Artikelname: TSC2 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A0492
Hersteller Artikelnummer: A0492
Alternativnummer: ABB-A0492-100UL,ABB-A0492-20UL,ABB-A0492-500UL,ABB-A0492-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: LAM, TSC4, PPP1R160, TSC2
This gene is a tumor suppressor gene that encodes the growth inhibitory protein tuberin. Tuberin interacts with hamartin to form the TSC protein complex which functions in the control of cell growth. This TSC protein complex negatively regulates mammalian target of rapamycin complex 1 (mTORC1) signaling which is a major regulator of anabolic cell growth. Mutations in this gene have been associated with tuberous sclerosis and lymphangioleiomyomatosis.
Klonalität: Polyclonal
Molekulargewicht: 201kDa
NCBI: 7249
UniProt: P49815
Reinheit: Affinity purification
Sequenz: TAPAAKPEKASAGTRVPVQEKTNLAAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRDTALYKSLSV
Target-Kategorie: TSC2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Protein phosphorylation,Cancer,Tumor suppressors,Signal Transduction,G protein signaling,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Autophagy,Cell Cycle,Cell cycle inhibitors,Endocrine Metabolism,AMPK Signaling Pathway,Insulin Receptor Signaling Pathway,Endocrine and metabolic diseases,Obesity,Immunology Inflammation