TSC2 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0492
Article Name: TSC2 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0492
Supplier Catalog Number: A0492
Alternative Catalog Number: ABB-A0492-100UL,ABB-A0492-20UL,ABB-A0492-500UL,ABB-A0492-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LAM, TSC4, PPP1R160, TSC2
This gene is a tumor suppressor gene that encodes the growth inhibitory protein tuberin. Tuberin interacts with hamartin to form the TSC protein complex which functions in the control of cell growth. This TSC protein complex negatively regulates mammalian target of rapamycin complex 1 (mTORC1) signaling which is a major regulator of anabolic cell growth. Mutations in this gene have been associated with tuberous sclerosis and lymphangioleiomyomatosis.
Clonality: Polyclonal
Molecular Weight: 201kDa
NCBI: 7249
UniProt: P49815
Purity: Affinity purification
Sequence: TAPAAKPEKASAGTRVPVQEKTNLAAYVPLLTQGWAEILVRRPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKEHRDTALYKSLSV
Target: TSC2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Protein phosphorylation,Cancer,Tumor suppressors,Signal Transduction,G protein signaling,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Autophagy,Cell Cycle,Cell cycle inhibitors,Endocrine Metabolism,AMPK Signaling Pathway,Insulin Receptor Signaling Pathway,Endocrine and metabolic diseases,Obesity,Immunology Inflammation