UBE2B Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: UBE2B Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0503
• Hersteller Artikelnummer: A0503
• Alternativnummer: ABB-A0503-20UL,ABB-A0503-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HR6B, UBC2, HHR6B, RAD6B, E2-17kDa, UBE2B

Produktbeschreibung

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair. Its protein sequence is 100% identical to the mouse, rat, and rabbit homologs, which indicates that this enzyme is highly conserved in eukaryotic evolution.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC2512]
• Molekulargewicht: 17kDa
• NCBI: 7320
• UniProt: P63146
• Reinheit: Affinity purification
• Sequenz: FKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS
• Target-Kategorie: UBE2B
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:6000|IHC-P,1:500 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,DNA Damage Repair,Cancer,Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Endocrine Metabolism,Nucleotide metabolism

Bilder