UBE2B Rabbit mAb, Unconjugated

Product Overview

• Article Name: UBE2B Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A0503
• Supplier Catalog Number: A0503
• Alternative Catalog Number: ABB-A0503-20UL,ABB-A0503-100UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: HR6B, UBC2, HHR6B, RAD6B, E2-17kDa, UBE2B

Product Description

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair. Its protein sequence is 100% identical to the mouse, rat, and rabbit homologs, which indicates that this enzyme is highly conserved in eukaryotic evolution.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC2512]
• Molecular Weight: 17kDa
• NCBI: 7320
• UniProt: P63146
• Purity: Affinity purification
• Sequence: FKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS
• Target: UBE2B
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:6000|IHC-P,1:500 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,DNA Damage Repair,Cancer,Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Endocrine Metabolism,Nucleotide metabolism

Images