GTF2F2 Rabbit mAb, Unconjugated
Artikelnummer:
ABB-A0536
- Bilder (2)
| Artikelname: | GTF2F2 Rabbit mAb, Unconjugated |
| Artikelnummer: | ABB-A0536 |
| Hersteller Artikelnummer: | A0536 |
| Alternativnummer: | ABB-A0536-100UL,ABB-A0536-20UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BTF4, RAP30, TF2F2, TFIIF, GTF2F2 |
| Predicted to enable RNA polymerase II general transcription initiation factor activity. Involved in transcription by RNA polymerase II. Located in microtubule cytoskeleton and nucleoplasm. Part of transcription preinitiation complex. |
| Klonalität: | Monoclonal |
| Klon-Bezeichnung: | [ARC2513] |
| Molekulargewicht: | 28kDa |
| NCBI: | 2963 |
| UniProt: | P13984 |
| Reinheit: | Affinity purification |
| Sequenz: | MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESS |
| Target-Kategorie: | GTF2F2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:6000|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling |


