GTF2F2 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A0536
Artikelname: GTF2F2 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A0536
Hersteller Artikelnummer: A0536
Alternativnummer: ABB-A0536-100UL,ABB-A0536-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: BTF4, RAP30, TF2F2, TFIIF, GTF2F2
Predicted to enable RNA polymerase II general transcription initiation factor activity. Involved in transcription by RNA polymerase II. Located in microtubule cytoskeleton and nucleoplasm. Part of transcription preinitiation complex.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2513]
Molekulargewicht: 28kDa
NCBI: 2963
UniProt: P13984
Reinheit: Affinity purification
Sequenz: MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESS
Target-Kategorie: GTF2F2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:6000|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling