GTF2F2 Rabbit mAb, Unconjugated

Product Overview

• Article Name: GTF2F2 Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A0536
• Supplier Catalog Number: A0536
• Alternative Catalog Number: ABB-A0536-100UL,ABB-A0536-20UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: BTF4, RAP30, TF2F2, TFIIF, GTF2F2

Product Description

Predicted to enable RNA polymerase II general transcription initiation factor activity. Involved in transcription by RNA polymerase II. Located in microtubule cytoskeleton and nucleoplasm. Part of transcription preinitiation complex.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC2513]
• Molecular Weight: 28kDa
• NCBI: 2963
• UniProt: P13984
• Purity: Affinity purification
• Sequence: MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESS
• Target: GTF2F2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:6000|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling

Images