Grp75/MOT/HSPA9 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A0558
- Bilder (2)
| Artikelname: | Grp75/MOT/HSPA9 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A0558 |
| Hersteller Artikelnummer: | A0558 |
| Alternativnummer: | ABB-A0558-100UL,ABB-A0558-20UL,ABB-A0558-500UL,ABB-A0558-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CSA, MOT, MOT2, SAAN, CRP40, EVPLS, GRP75, PBP74, GRP-75, HSPA9B, SIDBA4, MTHSP75, HEL-S-124m, Grp75/MOT/HSPA9 |
| This gene encodes a member of the heat shock protein 70 gene family. The encoded protein is primarily localized to the mitochondria but is also found in the endoplasmic reticulum, plasma membrane and cytoplasmic vesicles. This protein is a heat-shock cognate protein. This protein plays a role in cell proliferation, stress response and maintenance of the mitochondria. A pseudogene of this gene is found on chromosome 2. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 74kDa |
| NCBI: | 3313 |
| UniProt: | P38646 |
| Reinheit: | Affinity purification |
| Sequenz: | IGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIR |
| Target-Kategorie: | HSPA9 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cancer,Tumor biomarkers,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers |
|
|
|
|
|
Produktgarantie und fachkundiger Support
