Grp75/MOT/HSPA9 Rabbit pAb, Unconjugated

Catalog Number: ABB-A0558
Article Name: Grp75/MOT/HSPA9 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0558
Supplier Catalog Number: A0558
Alternative Catalog Number: ABB-A0558-100UL,ABB-A0558-20UL,ABB-A0558-500UL,ABB-A0558-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CSA, MOT, MOT2, SAAN, CRP40, EVPLS, GRP75, PBP74, GRP-75, HSPA9B, SIDBA4, MTHSP75, HEL-S-124m, Grp75/MOT/HSPA9
This gene encodes a member of the heat shock protein 70 gene family. The encoded protein is primarily localized to the mitochondria but is also found in the endoplasmic reticulum, plasma membrane and cytoplasmic vesicles. This protein is a heat-shock cognate protein. This protein plays a role in cell proliferation, stress response and maintenance of the mitochondria. A pseudogene of this gene is found on chromosome 2.
Clonality: Polyclonal
Molecular Weight: 74kDa
NCBI: 3313
UniProt: P38646
Purity: Affinity purification
Sequence: IGEVILVGGMTRMPKVQQTVQDLFGRAPSKAVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIR
Target: HSPA9
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cancer,Tumor biomarkers,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers