HSP60/HSPD1 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: HSP60/HSPD1 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0564
• Hersteller Artikelnummer: A0564
• Alternativnummer: ABB-A0564-100UL,ABB-A0564-20UL,ABB-A0564-1000UL,ABB-A0564-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human HSP60/HSPD1 (P10809).
• Konjugation: Unconjugated
• Alternative Synonym: HLD4, CPN60, GROEL, HSP60, HSP65, SPG13, HSP-60, HuCHA60, HSP60/HSPD1

Produktbeschreibung

This gene encodes a member of the chaperonin family. The encoded mitochondrial protein may function as a signaling molecule in the innate immune system. This protein is essential for the folding and assembly of newly imported proteins in the mitochondria. This gene is adjacent to a related family member and the region between the 2 genes functions as a bidirectional promoter. Several pseudogenes have been associated with this gene. Two transcript variants encoding the same protein have been identified for this gene. Mutations associated with this gene cause autosomal recessive spastic paraplegia 13.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC0260]
• Molekulargewicht: 61kDa
• NCBI: 3329
• UniProt: P10809
• Reinheit: Affinity purification
• Sequenz: VTKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPA
• Target-Kategorie: HSPD1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:5000 - 1:30000|IHC-P,1:2000 - 1:8000|IF/ICC,1:100 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat,Wheat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Endocrine Metabolism,Mitochondrial metabolism

Bilder