HSP60/HSPD1 Rabbit mAb, Unconjugated

Catalog Number: ABB-A0564
Article Name: HSP60/HSPD1 Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A0564
Supplier Catalog Number: A0564
Alternative Catalog Number: ABB-A0564-100UL,ABB-A0564-20UL,ABB-A0564-1000UL,ABB-A0564-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 350-450 of human HSP60/HSPD1 (P10809).
Conjugation: Unconjugated
Alternative Names: HLD4, CPN60, GROEL, HSP60, HSP65, SPG13, HSP-60, HuCHA60, HSP60/HSPD1
This gene encodes a member of the chaperonin family. The encoded mitochondrial protein may function as a signaling molecule in the innate immune system. This protein is essential for the folding and assembly of newly imported proteins in the mitochondria. This gene is adjacent to a related family member and the region between the 2 genes functions as a bidirectional promoter. Several pseudogenes have been associated with this gene. Two transcript variants encoding the same protein have been identified for this gene. Mutations associated with this gene cause autosomal recessive spastic paraplegia 13.
Clonality: Monoclonal
Clone Designation: [ARC0260]
Molecular Weight: 61kDa
NCBI: 3329
UniProt: P10809
Purity: Affinity purification
Sequence: VTKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPA
Target: HSPD1
Antibody Type: Primary Antibody
Application Dilute: WB,1:5000 - 1:30000|IHC-P,1:2000 - 1:8000|IF/ICC,1:100 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat,Wheat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Endocrine Metabolism,Mitochondrial metabolism