PIST/GOPC Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: PIST/GOPC Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0582
• Hersteller Artikelnummer: A0582
• Alternativnummer: ABB-A0582-20UL,ABB-A0582-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CAL, FIG, PIST, GOPC1, dJ94G16.2, PIST/GOPC

Produktbeschreibung

This gene encodes a Golgi protein with a PDZ domain. The PDZ domain is globular and proteins which contain them bind other proteins through short motifs near the C-termini. Mice which are deficient in the orthologous protein have globozoospermia and are infertile. Multiple transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC1831]
• Molekulargewicht: 51kDa
• NCBI: 57120
• UniProt: Q9HD26
• Reinheit: Affinity purification
• Sequenz: MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVD
• Target-Kategorie: GOPC
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Autophagy

Bilder