PIST/GOPC Rabbit mAb, Unconjugated

Catalog Number: ABB-A0582
Article Name: PIST/GOPC Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A0582
Supplier Catalog Number: A0582
Alternative Catalog Number: ABB-A0582-20UL,ABB-A0582-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CAL, FIG, PIST, GOPC1, dJ94G16.2, PIST/GOPC
This gene encodes a Golgi protein with a PDZ domain. The PDZ domain is globular and proteins which contain them bind other proteins through short motifs near the C-termini. Mice which are deficient in the orthologous protein have globozoospermia and are infertile. Multiple transcript variants encoding different isoforms have been found for this gene.
Clonality: Monoclonal
Clone Designation: [ARC1831]
Molecular Weight: 51kDa
NCBI: 57120
UniProt: Q9HD26
Purity: Affinity purification
Sequence: MSAGGPCPAAAGGGPGGASCSVGAPGGVSMFRWLEVLEKEFDKAFVDVDLLLGEIDPDQADITYEGRQKMTSLSSCFAQLCHKAQSVSQINHKLEAQLVD
Target: GOPC
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Autophagy