HDGF Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: HDGF Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0589
• Hersteller Artikelnummer: A0589
• Alternativnummer: ABB-A0589-100UL,ABB-A0589-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HMG1L2, HDGF

Produktbeschreibung

This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growth of many tumors. This gene was thought initially to be located on chromosome X, however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC2522]
• Molekulargewicht: 27kDa
• NCBI: 3068
• UniProt: P51858
• Reinheit: Affinity purification
• Sequenz: YQSSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLVIDEPAKEKNEKGALKRRAGDLLEDSPKRPKEAENPEGEEKEAATLEVERPLPMEVEKNST
• Target-Kategorie: HDGF
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cancer,Tumor biomarkers,Cell Biology Developmental Biology,Growth factors

Bilder