HDGF Rabbit mAb, Unconjugated

Catalog Number: ABB-A0589
Article Name: HDGF Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A0589
Supplier Catalog Number: A0589
Alternative Catalog Number: ABB-A0589-100UL,ABB-A0589-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HMG1L2, HDGF
This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growth of many tumors. This gene was thought initially to be located on chromosome X, however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Clonality: Monoclonal
Clone Designation: [ARC2522]
Molecular Weight: 27kDa
NCBI: 3068
UniProt: P51858
Purity: Affinity purification
Sequence: YQSSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLVIDEPAKEKNEKGALKRRAGDLLEDSPKRPKEAENPEGEEKEAATLEVERPLPMEVEKNST
Target: HDGF
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Cancer,Tumor biomarkers,Cell Biology Developmental Biology,Growth factors