LAMP2 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: LAMP2 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0593
• Hersteller Artikelnummer: A0593
• Alternativnummer: ABB-A0593-100UL,ABB-A0593-20UL,ABB-A0593-1000UL,ABB-A0593-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: DND, LAMPB, CD107b, LAMP-2, LGP-96, LGP110, LAMP2

Produktbeschreibung

The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC0274]
• Molekulargewicht: 45kDa
• NCBI: 3920
• UniProt: P13473
• Reinheit: Affinity purification
• Sequenz: FSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTAQDCSADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF
• Target-Kategorie: LAMP2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:2000|IHC-P,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors,Cardiovascular,Heart

Bilder