LAMP2 Rabbit mAb, Unconjugated

Product Overview

• Article Name: LAMP2 Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A0593
• Supplier Catalog Number: A0593
• Alternative Catalog Number: ABB-A0593-100UL,ABB-A0593-20UL,ABB-A0593-1000UL,ABB-A0593-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: DND, LAMPB, CD107b, LAMP-2, LGP-96, LGP110, LAMP2

Product Description

The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC0274]
• Molecular Weight: 45kDa
• NCBI: 3920
• UniProt: P13473
• Purity: Affinity purification
• Sequence: FSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAFQINTFDLRVQPFNVTQGKYSTAQDCSADDDNFLVPIAVGAALAGVLILVLLAYFIGLKHHHAGYEQF
• Target: LAMP2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:2000|IHC-P,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors,Cardiovascular,Heart

Images