Lysozyme (LYZ) Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: Lysozyme (LYZ) Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0641
• Hersteller Artikelnummer: A0641
• Alternativnummer: ABB-A0641-20UL,ABB-A0641-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: LZM, LYZF1, Lysozyme (LYZ)

Produktbeschreibung

This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC0276]
• Molekulargewicht: 17kDa
• NCBI: 4069
• UniProt: P61626
• Reinheit: Affinity purification
• Sequenz: MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCS
• Target-Kategorie: LYZ
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:6000|IF-P,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Cardiovascular,Blood

Bilder