Lysozyme (LYZ) Rabbit mAb, Unconjugated

Catalog Number: ABB-A0641
Article Name: Lysozyme (LYZ) Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A0641
Supplier Catalog Number: A0641
Alternative Catalog Number: ABB-A0641-20UL,ABB-A0641-100UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LZM, LYZF1, Lysozyme (LYZ)
This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.
Clonality: Monoclonal
Clone Designation: [ARC0276]
Molecular Weight: 17kDa
NCBI: 4069
UniProt: P61626
Purity: Affinity purification
Sequence: MKALIVLGLVLLSVTVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCS
Target: LYZ
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:6000|IF-P,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Cardiovascular,Blood