[KO Validated] GARS Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: [KO Validated] GARS Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0651
• Hersteller Artikelnummer: A0651
• Alternativnummer: ABB-A0651-100UL,ABB-A0651-20UL,ABB-A0651-1000UL,ABB-A0651-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: GARS, HMN5, CMT2D, DSMAV, GlyRS, HMN5A, SMAD1, SMAJI, RS

Produktbeschreibung

This gene encodes glycyl-tRNA synthetase, one of the aminoacyl-tRNA synthetases that charge tRNAs with their cognate amino acids. The encoded enzyme is an (alpha)2 dimer which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis. Two transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC0514]
• Molekulargewicht: 83kDa
• NCBI: 2617
• UniProt: P41250
• Reinheit: Affinity purification
• Sequenz: RHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEE
• Target-Kategorie: GARS1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Endocrine Metabolism,Mitochondrial metabolism

Bilder