[KO Validated] GARS Rabbit mAb, Unconjugated

Catalog Number: ABB-A0651
Article Name: [KO Validated] GARS Rabbit mAb, Unconjugated
Biozol Catalog Number: ABB-A0651
Supplier Catalog Number: A0651
Alternative Catalog Number: ABB-A0651-100UL,ABB-A0651-20UL,ABB-A0651-1000UL,ABB-A0651-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GARS, HMN5, CMT2D, DSMAV, GlyRS, HMN5A, SMAD1, SMAJI, RS
This gene encodes glycyl-tRNA synthetase, one of the aminoacyl-tRNA synthetases that charge tRNAs with their cognate amino acids. The encoded enzyme is an (alpha)2 dimer which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis. Two transcript variants encoding different isoforms have been found for this gene.
Clonality: Monoclonal
Clone Designation: [ARC0514]
Molecular Weight: 83kDa
NCBI: 2617
UniProt: P41250
Purity: Affinity purification
Sequence: RHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEE
Target: GARS1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Endocrine Metabolism,Mitochondrial metabolism