RCC1 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: RCC1 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A0662
• Hersteller Artikelnummer: A0662
• Alternativnummer: ABB-A0662-20UL,ABB-A0662-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CHC1, RCC1-I, RCC1

Produktbeschreibung

Enables several functions, including guanyl-nucleotide exchange factor activity, nucleosomal DNA binding activity, and protein heterodimerization activity. Involved in several processes, including G1/S transition of mitotic cell cycle, regulation of mitotic nuclear division, and spindle organization. Located in chromatin, cytoplasm, and nucleus. Part of protein-containing complex.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC1834]
• Molekulargewicht: 45kDa
• NCBI: 1104
• UniProt: P18754
• Reinheit: Affinity purification
• Sequenz: MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALG
• Target-Kategorie: RCC1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Cell Cycle

Bilder