C/EBPB Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: C/EBPB Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A0711
• Hersteller Artikelnummer: A0711
• Alternativnummer: ABB-A0711-100UL,ABB-A0711-20UL,ABB-A0711-1000UL,ABB-A0711-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: TCF5, IL6DBP, NF-IL6, C/EBP-beta, C/EBPB

Produktbeschreibung

This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 36kDa
• NCBI: 1051
• UniProt: P17676
• Reinheit: Affinity purification
• Sequenz: AELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAV
• Target-Kategorie: CEBPB
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Signal Transduction,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Cell Adhesion,Wnt -Catenin Signaling Pathway,Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Immunology Inflammation,Jak-Stat-IL-6 Receptor Signaling Pathway,Cardiovascular,Heart,Hypertrophy

Bilder