C/EBPB Rabbit pAb, Unconjugated

Catalog Number: ABB-A0711
Article Name: C/EBPB Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0711
Supplier Catalog Number: A0711
Alternative Catalog Number: ABB-A0711-100UL,ABB-A0711-20UL,ABB-A0711-1000UL,ABB-A0711-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TCF5, IL6DBP, NF-IL6, C/EBP-beta, C/EBPB
This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions.
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 1051
UniProt: P17676
Purity: Affinity purification
Sequence: AELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAV
Target: CEBPB
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Signal Transduction,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Cell Adhesion,Wnt -Catenin Signaling Pathway,Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Immunology Inflammation,Jak-Stat-IL-6 Receptor Signaling Pathway,Cardiovascular,Heart,Hypertrophy