[KO Validated] Rap1A Rabbit pAb, Unconjugated

Artikelnummer: ABB-A0975
Artikelname: [KO Validated] Rap1A Rabbit pAb, Unconjugated
Artikelnummer: ABB-A0975
Hersteller Artikelnummer: A0975
Alternativnummer: ABB-A0975-100UL,ABB-A0975-20UL,ABB-A0975-1000UL,ABB-A0975-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: RAP1, C21KG, G-22K, KREV1, KREV-1, SMGP21, 1A
This gene encodes a member of the Ras family of small GTPases. The encoded protein undergoes a change in conformational state and activity, depending on whether it is bound to GTP or GDP. This protein is activated by several types of guanine nucleotide exchange factors (GEFs), and inactivated by two groups of GTPase-activating proteins (GAPs). The activation status of the encoded protein is therefore affected by the balance of intracellular levels of GEFs and GAPs. The encoded protein regulates signaling pathways that affect cell proliferation and adhesion, and may play a role in tumor malignancy. Pseudogenes of this gene have been defined on chromosomes 14 and 17. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 21kDa
NCBI: 5906
UniProt: P62834
Reinheit: Affinity purification
Sequenz: SYRKQVEVDCQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQGQNLARQW
Target-Kategorie: RAP1A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,G-Protein-Coupled Receptors Signaling to MAPK Erk,MAPK-Erk Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway