[KO Validated] Rap1A Rabbit pAb, Unconjugated

Catalog Number: ABB-A0975
Article Name: [KO Validated] Rap1A Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A0975
Supplier Catalog Number: A0975
Alternative Catalog Number: ABB-A0975-100UL,ABB-A0975-20UL,ABB-A0975-1000UL,ABB-A0975-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RAP1, C21KG, G-22K, KREV1, KREV-1, SMGP21, 1A
This gene encodes a member of the Ras family of small GTPases. The encoded protein undergoes a change in conformational state and activity, depending on whether it is bound to GTP or GDP. This protein is activated by several types of guanine nucleotide exchange factors (GEFs), and inactivated by two groups of GTPase-activating proteins (GAPs). The activation status of the encoded protein is therefore affected by the balance of intracellular levels of GEFs and GAPs. The encoded protein regulates signaling pathways that affect cell proliferation and adhesion, and may play a role in tumor malignancy. Pseudogenes of this gene have been defined on chromosomes 14 and 17. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 5906
UniProt: P62834
Purity: Affinity purification
Sequence: SYRKQVEVDCQQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTEDVPMILVGNKCDLEDERVVGKEQGQNLARQW
Target: RAP1A
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Small G proteins,G-Protein-Coupled Receptors Signaling to MAPK Erk,MAPK-Erk Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway