CACNG1 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10014
Artikelname: CACNG1 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10014
Hersteller Artikelnummer: A10014
Alternativnummer: ABB-A10014-100UL,ABB-A10014-20UL,ABB-A10014-1000UL,ABB-A10014-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CACNLG, CACNG1
Voltage-dependent calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of two known gamma subunit proteins. This particular gamma subunit is part of skeletal muscle 1,4-dihydropyridine-sensitive calcium channels and is an integral membrane protein that plays a role in excitation-contraction coupling. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members that function as transmembrane AMPA receptor regulatory proteins (TARPs).
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 786
UniProt: Q06432
Reinheit: Affinity purification
Sequenz: DHWAVLSPHMEHHNTTCEAAHFGLWRICTKRIPMDDSKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI
Target-Kategorie: CACNG1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:4000|IF/ICC, 1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience,Calcium Signaling
Immunofluorescence analysi