CACNG1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A10014
Article Name: CACNG1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10014
Supplier Catalog Number: A10014
Alternative Catalog Number: ABB-A10014-100UL,ABB-A10014-20UL,ABB-A10014-1000UL,ABB-A10014-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CACNLG, CACNG1
Voltage-dependent calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of two known gamma subunit proteins. This particular gamma subunit is part of skeletal muscle 1,4-dihydropyridine-sensitive calcium channels and is an integral membrane protein that plays a role in excitation-contraction coupling. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members that function as transmembrane AMPA receptor regulatory proteins (TARPs).
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 786
UniProt: Q06432
Purity: Affinity purification
Sequence: DHWAVLSPHMEHHNTTCEAAHFGLWRICTKRIPMDDSKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI
Target: CACNG1
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:4000|IF/ICC, 1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience,Calcium Signaling
Immunofluorescence analysi