YAP1 Rabbit pAb, Unconjugated
Artikelnummer:
ABB-A1002
- Bilder (2)
| Artikelname: | YAP1 Rabbit pAb, Unconjugated |
| Artikelnummer: | ABB-A1002 |
| Hersteller Artikelnummer: | A1002 |
| Alternativnummer: | ABB-A1002-100UL,ABB-A1002-20UL,ABB-A1002-1000UL,ABB-A1002-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, IHC-P, IP, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | YAP, YKI, COB1, YAP2, YAP-1, YAP65, YAP1 |
| This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 54kDa |
| NCBI: | 10413 |
| UniProt: | P46937 |
| Reinheit: | Affinity purification |
| Sequenz: | PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSV |
| Target-Kategorie: | YAP1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:2000 - 1:20000|IHC-P,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Cancer,Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology |


