YAP1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: YAP1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A1002
• Supplier Catalog Number: A1002
• Alternative Catalog Number: ABB-A1002-100UL,ABB-A1002-20UL,ABB-A1002-1000UL,ABB-A1002-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, IP, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: YAP, YKI, COB1, YAP2, YAP-1, YAP65, YAP1

Product Description

This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. This gene is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 54kDa
• NCBI: 10413
• UniProt: P46937
• Purity: Affinity purification
• Sequence: PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSV
• Target: YAP1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:2000 - 1:20000|IHC-P,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Protein phosphorylation,Cancer,Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology.

Images

Immunohistochemistry analysis of paraffin-embedded Human colon (low expression samples) using YAP1 Rabbit pAb (A1002) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using YAP1 Rabbit pAb (A1002) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Western blot analysis of lysates from wild type (WT) and YAP1 knockout (KO)HeLa cellsusingYAP1 Rabbit pAb (A1002) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:30s.

Immunohistochemistry analysis of paraffin-embedded Human liver cancer using YAP1 Rabbit pAb (A1002) at dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Confocal immunofluorescence analysis of U2OS cells using YAP1 Rabbit pAb (A1002) at dilution of 1:200. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using YAP1 Rabbit pAb (A1002) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U2OS cells using YAP1 Rabbit pAb (A1002) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunoprecipitation analysis of 300 µg extracts of HeLa cells using 3 µg YAP1 antibody (A1002). Western blot was performed from the immunoprecipitate using YAP1 antibody (A1002) at a dilution of 1:1000.

Immunoprecipitation analysis of 300 µg extracts of HeLa cells using 3 µg YAP1 antibody (A1002). Western blot was performed from the immunoprecipitate using YAP1 (A1002) at a dilution of 1:1000.