MCCC1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: MCCC1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A10020
• Hersteller Artikelnummer: A10020
• Alternativnummer: ABB-A10020-20UL,ABB-A10020-100UL,ABB-A10020-1000UL,ABB-A10020-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MCCA, MCC-B, MCCCalpha, MCCC1

Produktbeschreibung

This gene encodes the large subunit of 3-methylcrotonyl-CoA carboxylase. This enzyme functions as a heterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoA to form 3-methylglutaconyl-CoA. Mutations in this gene are associated with 3-Methylcrotonylglycinuria, an autosomal recessive disorder of leucine catabolism.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 80kDa
• NCBI: 56922
• UniProt: Q96RQ3
• Reinheit: Affinity purification
• Sequenz: VSSQETQGGPLAPMTGTIEKVFVKAGDKVKAGDSLMVMIAMKMEHTIKSPKDGTVKKVFYREGAQANRHTPLVEFEEEESDKRESE
• Target-Kategorie: MCCC1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Amino acid metabolism

Bilder