MCCC1 Rabbit pAb, Unconjugated

Catalog Number: ABB-A10020
Article Name: MCCC1 Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10020
Supplier Catalog Number: A10020
Alternative Catalog Number: ABB-A10020-20UL,ABB-A10020-100UL,ABB-A10020-1000UL,ABB-A10020-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MCCA, MCC-B, MCCCalpha, MCCC1
This gene encodes the large subunit of 3-methylcrotonyl-CoA carboxylase. This enzyme functions as a heterodimer and catalyzes the carboxylation of 3-methylcrotonyl-CoA to form 3-methylglutaconyl-CoA. Mutations in this gene are associated with 3-Methylcrotonylglycinuria, an autosomal recessive disorder of leucine catabolism.
Clonality: Polyclonal
Molecular Weight: 80kDa
NCBI: 56922
UniProt: Q96RQ3
Purity: Affinity purification
Sequence: VSSQETQGGPLAPMTGTIEKVFVKAGDKVKAGDSLMVMIAMKMEHTIKSPKDGTVKKVFYREGAQANRHTPLVEFEEEESDKRESE
Target: MCCC1
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:100|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Amino acid metabolism