UPK3A Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10034
Artikelname: UPK3A Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10034
Hersteller Artikelnummer: A10034
Alternativnummer: ABB-A10034-100UL,ABB-A10034-20UL,ABB-A10034-1000UL,ABB-A10034-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: UP3A, UPK3, UPIII, UPIIIA, UPK3A
This gene encodes a member of the uroplakin family, a group of transmembrane proteins that form complexes on the apical surface of the bladder epithelium. Mutations in this gene may be associated with renal adysplasia. Alternatively spliced transcript variants have been described.
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 7380
UniProt: O75631
Reinheit: Affinity purification
Sequenz: VNLQPQLASVTFATNNPTLTTVALEKPLCMFDSKEALTGTHEVYLYVLVDSAISRNASVQDSTNTPLGSTFLQTEGGRTGPYKAVAFDLIPCSDLPSLDAIGDVSKASQILNAYLVRVGANGTCLWDPNFQGLCNAPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTPYSTIDTWPGRRSGG
Target-Kategorie: UPK3A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat