UPK3A Rabbit pAb, Unconjugated

Catalog Number: ABB-A10034
Article Name: UPK3A Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A10034
Supplier Catalog Number: A10034
Alternative Catalog Number: ABB-A10034-100UL,ABB-A10034-20UL,ABB-A10034-1000UL,ABB-A10034-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: UP3A, UPK3, UPIII, UPIIIA, UPK3A
This gene encodes a member of the uroplakin family, a group of transmembrane proteins that form complexes on the apical surface of the bladder epithelium. Mutations in this gene may be associated with renal adysplasia. Alternatively spliced transcript variants have been described.
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 7380
UniProt: O75631
Purity: Affinity purification
Sequence: VNLQPQLASVTFATNNPTLTTVALEKPLCMFDSKEALTGTHEVYLYVLVDSAISRNASVQDSTNTPLGSTFLQTEGGRTGPYKAVAFDLIPCSDLPSLDAIGDVSKASQILNAYLVRVGANGTCLWDPNFQGLCNAPLSAATEYRFKYVLVNMSTGLVEDQTLWSDPIRTNQLTPYSTIDTWPGRRSGG
Target: UPK3A
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat