DAG1 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A10076
Artikelname: DAG1 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A10076
Hersteller Artikelnummer: A10076
Alternativnummer: ABB-A10076-20UL,ABB-A10076-100UL,ABB-A10076-500UL,ABB-A10076-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: A3a, DAG, AGRNR, 156DAG, MDDGA9, MDDGC7, MDDGC9, LGMDR16, DAG1
This gene encodes dystroglycan, a central component of dystrophin-glycoprotein complex that links the extracellular matrix and the cytoskeleton in the skeletal muscle. The encoded preproprotein undergoes O- and N-glycosylation, and proteolytic processing to generate alpha and beta subunits. Certain mutations in this gene are known to cause distinct forms of muscular dystrophy. Alternative splicing results in multiple transcript variants, all encoding the same protein.
Klonalität: Polyclonal
Molekulargewicht: 97kDa
NCBI: 1605
UniProt: Q14118
Reinheit: Affinity purification
Sequenz: RKKRKGKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETTPLNQDTMGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Target-Kategorie: DAG1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|IF/ICC,1:20 - 1:100|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Neuroscience